1TLY: Comparison of partiFold prediction against known X-ray crystal structure

Comparison of Secondary Structure assignment:

The Standard Output text shown below is the same output that partiFold returns, as described in the partiFold Documentation, however, the additional last (fourth) row indicates the secondary structure labeling which STRIDE infers from the protein crystal structure.

10 20 30 40 50 60 70 80 90 100 | | | | | | | | | | AENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFK ................MCMCMCMCMCMCMCEEooooooooooooCMCMCMCMCMCMCMCMEEiiiiiMCMCMCMCMCMCMoooMCMCMCMCMCMCMEEii ................MCMCMCMCMCMCMCMCooooooooooooEEEEEMCMCMCMCMCMCMiiiiiMCMCMCMCMCMCMoooEEEEMCMCMCMCMCMii ........TTTTEEEEEEEEEEEEECCTTTTEEEEEEEEEEEEEETTEEEEEEEEEET................TCEEEEEEEEEHHHHHCCCCCBTTEE 110 120 130 140 150 160 170 180 190 200 | | | | | | | | | | EWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG iMCMCMCMCMCMooooooooMCMCMCMCMCMEEiiiMCMCMCMCMCMCMoooooooooooMCMCMCMCMCMCMEEiiiMCMCMCMCMCMCMooooooooo iMCMCMCMCMCMooooooooMCMCMCMCMCMCMiiiMCMCMCMCMCMCMoooooooooooEEMCMCMCMCMCMCMiiiMCMCMCMCMCMCMooooooooo EEEEEEEEEEECTTTTTTTEEEEEEEEEEEECCCTTTEEEEEEEEEEEEEETTTTTTTEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEECCTTTTTTC 210 220 230 240 250 260 270 | | | | | | | NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNFHHHHHH oooooooooooMCMCMCMCMCMCMiiMCMCMCMCMCooooooooooooooooooooooooooCMCMCMCMCMEEEE.. oooooooooooEEECMCMCMCMCMiiMCMCMCMCMCooooooooooooooooooooooooooCMCMCMCMCMCMCM.. BTTTTCBCBCCCEEEEEEEEEEETTTEEEEEEEEEEETGGGBTTTEEETTTTTCEEECCCEEEEEEEEEEEECCC... energy : -9.53069260018128e+01 Partition function value: 10-TMB: 3.258288e+65 12-TMB: 9.952453e+68 Total: 9.955711e+68

Comparison of Stochastic Contact Map versus single crystal structure contacts:



Comparison of F-measure/Sensitivity/PPV for contact map thresholds:




partiFold downloadable output files:




partiFold's homepage